| Name | FAM36A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4394 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM36A antibody was raised using the middle region of FAM36A corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM36A Blocking Peptide |
| Description | Rabbit polyclonal FAM36A antibody raised against the middle region of FAM36A |
| Gene | COX20 |
| Supplier Page | Shop |