| Name | UPB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2279 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG |
| Purity/Format | Affinity purified |
| Blocking Peptide | UPB1 Blocking Peptide |
| Description | Rabbit polyclonal UPB1 antibody raised against the middle region of UPB1 |
| Gene | UPB1 |
| Supplier Page | Shop |