Name | PSMB9 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5740 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PSMB9 antibody was raised using the C terminal of PSMB9 corresponding to a region with amino acids RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE |
Purity/Format | Affinity purified |
Blocking Peptide | PSMB9 Blocking Peptide |
Description | Rabbit polyclonal PSMB9 antibody raised against the C terminal of PSMB9 |
Gene | PSMB9 |
Supplier Page | Shop |