| Name | PSMB9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5740 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PSMB9 antibody was raised using the C terminal of PSMB9 corresponding to a region with amino acids RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PSMB9 Blocking Peptide |
| Description | Rabbit polyclonal PSMB9 antibody raised against the C terminal of PSMB9 |
| Gene | PSMB9 |
| Supplier Page | Shop |