| Name | QPCTL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7419 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | QPCTL antibody was raised using the middle region of QPCTL corresponding to a region with amino acids QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML |
| Purity/Format | Affinity purified |
| Blocking Peptide | QPCTL Blocking Peptide |
| Description | Rabbit polyclonal QPCTL antibody raised against the middle region of QPCTL |
| Gene | QPCTL |
| Supplier Page | Shop |