Anti-GJC2 antibody
| Name | Anti-GJC2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86215 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit, Cat |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 389-438 (PASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW I) of Human GJC2, NP_065168 |
| Description | Rabbit Polyclonal |
| Gene | GJC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
