PYCR1 antibody

Name PYCR1 antibody
Supplier Fitzgerald
Catalog 70R-5329
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR
Purity/Format Affinity purified
Blocking Peptide PYCR1 Blocking Peptide
Description Rabbit polyclonal PYCR1 antibody raised against the middle region of PYCR1
Gene PYCR1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.