| Name | DUSP8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5713 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DUSP8 antibody was raised using the middle region of DUSP8 corresponding to a region with amino acids PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP |
| Purity/Format | Affinity purified |
| Blocking Peptide | DUSP8 Blocking Peptide |
| Description | Rabbit polyclonal DUSP8 antibody raised against the middle region of DUSP8 |
| Gene | DUSP8 |
| Supplier Page | Shop |