| Name | SLC25A29 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1740 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC25A29 Blocking Peptide |
| Description | Rabbit polyclonal SLC25A29 antibody raised against the C terminal of SLC25A29 |
| Gene | SLC25A29 |
| Supplier Page | Shop |