PON1 antibody

Name PON1 antibody
Supplier Fitzgerald
Catalog 70R-5361
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PON1 antibody was raised using the middle region of PON1 corresponding to a region with amino acids VVAEGFDFANGINISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF
Purity/Format Affinity purified
Blocking Peptide PON1 Blocking Peptide
Description Rabbit polyclonal PON1 antibody raised against the middle region of PON1
Gene PON1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.