A1BG antibody

Name A1BG antibody
Supplier Fitzgerald
Catalog 70R-1579
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen A1BG antibody was raised using the N terminal of A1BG corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
Purity/Format Total IgG Protein A purified
Blocking Peptide A1BG Blocking Peptide
Description Rabbit polyclonal A1BG antibody raised against the N terminal of A1BG
Gene A1BG
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.