| Name | A1BG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1579 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | A1BG antibody was raised using the N terminal of A1BG corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | A1BG Blocking Peptide |
| Description | Rabbit polyclonal A1BG antibody raised against the N terminal of A1BG |
| Gene | A1BG |
| Supplier Page | Shop |