Name | AKTIP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2220 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | AKTIP antibody was raised using the middle region of AKTIP corresponding to a region with amino acids NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA |
Purity/Format | Affinity purified |
Blocking Peptide | AKTIP Blocking Peptide |
Description | Rabbit polyclonal AKTIP antibody raised against the middle region of AKTIP |
Gene | AKTIP |
Supplier Page | Shop |