| Name | PCCA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2509 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCCA Blocking Peptide |
| Description | Rabbit polyclonal PCCA antibody raised against the N terminal of PCCA |
| Gene | PCCA |
| Supplier Page | Shop |