LOC441956 antibody

• Supplier: Fitzgerald
• Catalog: 70R-1964
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: LOC441956 antibody was raised using the N terminal of LOC441956 corresponding to a region with amino acids APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK
• Purity/Format: Affinity purified
• Blocking Peptide: LOC441956 Blocking Peptide
• Description: Rabbit polyclonal LOC441956 antibody raised against the N terminal of LOC441956
• Gene: LOC441956