Name | KIF1C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1611 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog |
Antigen | KIF1C antibody was raised using the C terminal of KIF1C corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | KIF1C Blocking Peptide |
Description | Rabbit polyclonal KIF1C antibody raised against the C terminal of KIF1C |
Gene | KIF1C |
Supplier Page | Shop |