| Name | KIF1C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1611 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | KIF1C antibody was raised using the C terminal of KIF1C corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KIF1C Blocking Peptide |
| Description | Rabbit polyclonal KIF1C antibody raised against the C terminal of KIF1C |
| Gene | KIF1C |
| Supplier Page | Shop |