Name | VIPAR antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3631 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI |
Purity/Format | Affinity purified |
Blocking Peptide | VIPAR Blocking Peptide |
Description | Rabbit polyclonal VIPAR antibody raised against the middle region of VIPAR |
Gene | VIPAS39 |
Supplier Page | Shop |