| Name | VIPAR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3631 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI |
| Purity/Format | Affinity purified |
| Blocking Peptide | VIPAR Blocking Peptide |
| Description | Rabbit polyclonal VIPAR antibody raised against the middle region of VIPAR |
| Gene | VIPAS39 |
| Supplier Page | Shop |