VPS8 antibody

Name VPS8 antibody
Supplier Fitzgerald
Catalog 70R-3086
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen VPS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGFAKGQITMWDLASGKLLRSITDAHPPGTAILHIKFTDDPTLAICNDSG
Purity/Format Affinity purified
Blocking Peptide VPS8 Blocking Peptide
Description Rabbit polyclonal VPS8 antibody
Gene VPS8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.