FAM160B1 antibody

Name FAM160B1 antibody
Supplier Fitzgerald
Catalog 70R-4079
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FAM160B1 antibody was raised using the N terminal of FAM160B1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH
Purity/Format Affinity purified
Blocking Peptide FAM160B1 Blocking Peptide
Description Rabbit polyclonal FAM160B1 antibody raised against the N terminal of FAM160B1
Gene FAM160B1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.