NAT15 antibody

Name NAT15 antibody
Supplier Fitzgerald
Catalog 70R-2380
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
Purity/Format Affinity purified
Blocking Peptide NAT15 Blocking Peptide
Description Rabbit polyclonal NAT15 antibody
Gene NAA60
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.