LRRC24 antibody

Name LRRC24 antibody
Supplier Fitzgerald
Catalog 70R-6429
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL
Purity/Format Affinity purified
Blocking Peptide LRRC24 Blocking Peptide
Description Rabbit polyclonal LRRC24 antibody raised against the N terminal of LRRC24
Gene LRRC24
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.