| Name | LRRC24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6429 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC24 Blocking Peptide |
| Description | Rabbit polyclonal LRRC24 antibody raised against the N terminal of LRRC24 |
| Gene | LRRC24 |
| Supplier Page | Shop |