| Name | IFI44L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1290 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | IFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | IFI44L Blocking Peptide |
| Description | Rabbit polyclonal IFI44L antibody raised against the N terminal of IFI44L |
| Gene | IFI44L |
| Supplier Page | Shop |