| Name | DYNLL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2573 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Drosophila |
| Antigen | DYNLL1 antibody was raised using the N terminal of DYNLL1 corresponding to a region with amino acids MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY |
| Purity/Format | Affinity purified |
| Blocking Peptide | DYNLL1 Blocking Peptide |
| Description | Rabbit polyclonal DYNLL1 antibody raised against the N terminal of DYNLL1 |
| Gene | DYNLL1 |
| Supplier Page | Shop |