| Name | H2AFX antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2028 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | H2AFX antibody was raised using the N terminal of H2AFX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY |
| Purity/Format | Affinity purified |
| Blocking Peptide | H2AFX Blocking Peptide |
| Description | Rabbit polyclonal H2AFX antibody raised against the N terminal of H2AFX |
| Gene | H2AFX |
| Supplier Page | Shop |