Name | WDR55 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3310 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG |
Purity/Format | Affinity purified |
Blocking Peptide | WDR55 Blocking Peptide |
Description | Rabbit polyclonal WDR55 antibody raised against the middle region of WDR55 |
Gene | WDR55 |
Supplier Page | Shop |