| Name | RBM11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4591 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RBM11 antibody was raised using the middle region of RBM11 corresponding to a region with amino acids SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM11 Blocking Peptide |
| Description | Rabbit polyclonal RBM11 antibody raised against the middle region of RBM11 |
| Gene | RBM11 |
| Supplier Page | Shop |