Anti-GLE1 antibody
| Name | Anti-GLE1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81648 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Bovine, Cat, Dog, Pig, Yeast |
| Antigen | Synthetic peptide corresponding to a region within N terminal ammino acids 217-266 (LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASE Q) of human GLE1 (NP_001490) |
| Description | Rabbit Polyclonal |
| Gene | GLE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GLE1 antibody (ab81648) at 1 µg/ml + placenta lysate at 10 ug protein. SecondaryHRP conjugated anti-Rabbit IgG diluted 1/50,000 - 1/100,000.