| Name | HSPA1L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4431 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HSPA1L antibody was raised using the C terminal of HSPA1L corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
| Purity/Format | Affinity purified |
| Blocking Peptide | HSPA1L Blocking Peptide |
| Description | Rabbit polyclonal HSPA1L antibody raised against the C terminal of HSPA1L |
| Gene | HSPA1L |
| Supplier Page | Shop |