C3ORF24 antibody

Name C3ORF24 antibody
Supplier Fitzgerald
Catalog 70R-3887
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C3ORF24 antibody was raised using the middle region of C3Orf24 corresponding to a region with amino acids KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRV
Purity/Format Affinity purified
Blocking Peptide C3ORF24 Blocking Peptide
Description Rabbit polyclonal C3ORF24 antibody raised against the middle region of C3Orf24
Gene FANCD2OS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.