| Name | MAGEA4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4207 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MAGEA4 antibody was raised using the C terminal of MAGEA4 corresponding to a region with amino acids ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAGEA4 Blocking Peptide |
| Description | Rabbit polyclonal MAGEA4 antibody raised against the C terminal of MAGEA4 |
| Gene | MAGEA4 |
| Supplier Page | Shop |