| Name | Ribophorin II antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6845 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP |
| Purity/Format | Affinity purified |
| Blocking Peptide | Ribophorin II Blocking Peptide |
| Description | Rabbit polyclonal Ribophorin II antibody raised against the middle region of RPN2 |
| Gene | RPN2 |
| Supplier Page | Shop |