| Name | TCTE1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3599 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TCTE1 antibody was raised using the middle region of TCTE1 corresponding to a region with amino acids MNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSL |
| Purity/Format | Affinity purified |
| Blocking Peptide | TCTE1 Blocking Peptide |
| Description | Rabbit polyclonal TCTE1 antibody raised against the middle region of TCTE1 |
| Gene | TCTE1 |
| Supplier Page | Shop |