| Name | C20ORF18 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1161 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C20ORF18 antibody was raised using the middle region of C20Orf18 corresponding to a region with amino acids AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | C20ORF18 Blocking Peptide |
| Description | Rabbit polyclonal C20ORF18 antibody raised against the middle region of C20Orf18 |
| Gene | RBCK1 |
| Supplier Page | Shop |