Name | C20ORF18 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1161 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | C20ORF18 antibody was raised using the middle region of C20Orf18 corresponding to a region with amino acids AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | C20ORF18 Blocking Peptide |
Description | Rabbit polyclonal C20ORF18 antibody raised against the middle region of C20Orf18 |
Gene | RBCK1 |
Supplier Page | Shop |