| Name | FAM131C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4271 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM131C antibody was raised using the middle region of FAM131C corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM131C Blocking Peptide |
| Description | Rabbit polyclonal FAM131C antibody raised against the middle region of FAM131C |
| Gene | FAM131C |
| Supplier Page | Shop |