Name | FAM131C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4271 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM131C antibody was raised using the middle region of FAM131C corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF |
Purity/Format | Affinity purified |
Blocking Peptide | FAM131C Blocking Peptide |
Description | Rabbit polyclonal FAM131C antibody raised against the middle region of FAM131C |
Gene | FAM131C |
Supplier Page | Shop |