| Name | FKBP11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7231 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | FKBP11 antibody was raised using the N terminal of FKBP11 corresponding to a region with amino acids VRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | FKBP11 Blocking Peptide |
| Description | Rabbit polyclonal FKBP11 antibody raised against the N terminal of FKBP11 |
| Gene | FKBP11 |
| Supplier Page | Shop |