| Name | C6ORF140 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2829 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C6ORF140 antibody was raised using the N terminal Of C6Orf140 corresponding to a region with amino acids NPFQKEVVLDSWPDFKAVITRRQREAETDNLDHYTNAYAVFYKDVRAYRQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | C6ORF140 Blocking Peptide |
| Description | Rabbit polyclonal C6ORF140 antibody raised against the N terminal Of C6Orf140 |
| Gene | GLYATL3 |
| Supplier Page | Shop |