| Name | ANKRD5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3379 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ANKRD5 antibody was raised using the N terminal of ANKRD5 corresponding to a region with amino acids MTIVDNEGKGVLFYCILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ANKRD5 Blocking Peptide |
| Description | Rabbit polyclonal ANKRD5 antibody raised against the N terminal of ANKRD5 |
| Gene | ANKEF1 |
| Supplier Page | Shop |