| Name | DNALI1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3315 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DNALI1 antibody was raised using the N terminal of DNALI1 corresponding to a region with amino acids MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA |
| Purity/Format | Affinity purified |
| Blocking Peptide | DNALI1 Blocking Peptide |
| Description | Rabbit polyclonal DNALI1 antibody raised against the N terminal of DNALI1 |
| Gene | TMED5 |
| Supplier Page | Shop |