| Name | FAM70A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6882 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM70A antibody was raised using the N terminal of FAM70A corresponding to a region with amino acids IVDGVFAARHIDLKPLYANRCHYVPKTSQKEAEEVISSSTKNSPSTRVMR |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM70A Blocking Peptide |
| Description | Rabbit polyclonal FAM70A antibody raised against the N terminal of FAM70A |
| Gene | TMEM255A |
| Supplier Page | Shop |