| Name | PM20D2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4116 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | PM20D2 antibody was raised using the middle region of PM20D2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS |
| Purity/Format | Affinity purified |
| Blocking Peptide | PM20D2 Blocking Peptide |
| Description | Rabbit polyclonal PM20D2 antibody raised against the middle region of PM20D2 |
| Gene | PM20D2 |
| Supplier Page | Shop |