| Name | Copine I antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4852 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Copine I antibody was raised using the middle region of CPNE1 corresponding to a region with amino acids VQCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSG |
| Purity/Format | Affinity purified |
| Blocking Peptide | Copine I Blocking Peptide |
| Description | Rabbit polyclonal Copine I antibody raised against the middle region of CPNE1 |
| Gene | CPNE1 |
| Supplier Page | Shop |