| Name | ACP6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2674 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACP6 Blocking Peptide |
| Description | Rabbit polyclonal ACP6 antibody raised against the N terminal of ACP6 |
| Gene | ACP6 |
| Supplier Page | Shop |