| Name | CDH7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6178 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | CDH7 antibody was raised using the N terminal of CDH7 corresponding to a region with amino acids PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP |
| Purity/Format | Affinity purified |
| Blocking Peptide | CDH7 Blocking Peptide |
| Description | Rabbit polyclonal CDH7 antibody raised against the N terminal of CDH7 |
| Gene | CDH7 |
| Supplier Page | Shop |