| Name | Renin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1584 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Renin Blocking Peptide |
| Description | Rabbit polyclonal Renin antibody raised against the C terminal of REN |
| Gene | REN |
| Supplier Page | Shop |