CLPB antibody

Name CLPB antibody
Supplier Fitzgerald
Catalog 70R-3956
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH
Purity/Format Affinity purified
Blocking Peptide CLPB Blocking Peptide
Description Rabbit polyclonal CLPB antibody
Gene CLPB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.