Name | B4GALNT3 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7461 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | B4GALNT3 antibody was raised using the N terminal of B4GALNT3 corresponding to a region with amino acids NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA |
Purity/Format | Affinity purified |
Blocking Peptide | B4GALNT3 Blocking Peptide |
Description | Rabbit polyclonal B4GALNT3 antibody raised against the N terminal of B4GALNT3 |
Gene | B4GALNT3 |
Supplier Page | Shop |