Name | FAM62C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6914 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM62C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK |
Purity/Format | Affinity purified |
Blocking Peptide | FAM62C Blocking Peptide |
Description | Rabbit polyclonal FAM62C antibody |
Gene | ESYT3 |
Supplier Page | Shop |