Anti-GLIPR1L1 antibody
| Name | Anti-GLIPR1L1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102620 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 179-228 ( NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL ) of Human GLIPR1L1 (NP_689992) |
| Description | Rabbit Polyclonal |
| Gene | GLIPR1L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GLIPR1L1 antibody (ab102620) at 1 µg/ml + ACHN cell lysate at 10 µg