Name | Carboxyl Ester Lipase antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5366 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR |
Purity/Format | Affinity purified |
Blocking Peptide | Carboxyl Ester Lipase Blocking Peptide |
Description | Rabbit polyclonal Carboxyl Ester Lipase antibody |
Gene | SCGB1D1 |
Supplier Page | Shop |