Carboxyl Ester Lipase antibody

Name Carboxyl Ester Lipase antibody
Supplier Fitzgerald
Catalog 70R-5366
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Carboxyl Ester Lipase antibody was raised using a synthetic peptide corresponding to a region with amino acids VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR
Purity/Format Affinity purified
Blocking Peptide Carboxyl Ester Lipase Blocking Peptide
Description Rabbit polyclonal Carboxyl Ester Lipase antibody
Gene SCGB1D1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.