IFN Alpha 7 antibody

Name IFN Alpha 7 antibody
Supplier Fitzgerald
Catalog 70R-5430
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
Purity/Format Affinity purified
Blocking Peptide IFN Alpha 7 Blocking Peptide
Description Rabbit polyclonal IFN Alpha 7 antibody raised against the N terminal of IFNA7
Gene IFNA7
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.