| Name | KIF22 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1616 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KIF22 Blocking Peptide |
| Description | Rabbit polyclonal KIF22 antibody raised against the C terminal of KIF22 |
| Gene | AQP6 |
| Supplier Page | Shop |