| Name | FAM107A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1070 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM107A antibody was raised using the middle region of FAM107A corresponding to a region with amino acids RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FAM107A Blocking Peptide |
| Description | Rabbit polyclonal FAM107A antibody raised against the middle region of FAM107A |
| Gene | FAM107A |
| Supplier Page | Shop |